2. Neurological Disease

Neurological Disease

Neurological Disease

Related Products

PDF 88.0 MB

A range of neurological disorders, including epilepsy and dystonia, may involve dysfunctional intracortical inhibition, and may respond to treatments that modify it. Parkinson’s is a neurodegenerative disease characterized by increased activity of GABA in basal ganglia and the loss of dopamine in nigrostriatum, associated with rigidity, resting tremor, gait with accelerating steps, and fixed inexpressive face. Neurological deficits, along with neuromuscular involvement, are characteristic of mitochondrial disease, and these symptoms can have a dramatic impact on patient quality of life. Neurological features may be manifold, ranging from neural deafness, ataxia, peripheral neuropathy, migraine, seizures, stroke‐like episodes and dementia and depend on the part of the nervous system affected.

Cat. No. Product Name CAS No. Purity Chemical Structure
  • HY-W746075A
    (±)-Darifenacin N-Oxide 2416229-88-2 98%
    (±)-Darifenacin N-Oxide is the impurity of Darifenacin (HY-A0033). Darifenacin (UK-88525) is a selective and orally active M3 muscarinic receptor (M3R) antagonist with a pKi of 8.9.
    (±)-Darifenacin N-Oxide
  • HY-W750825A
    4,7,10,13,16,19-Docosahexaenoyl chloride 158754-21-3 98%
    4,7,10,13,16,19-Docosahexaenoyl chloride is an ester derivative formed by Iloperidone (HY-17410) metabolite P-88-8991 and polyunsaturated fatty acid (linoleic acid derivative), which acts as a prodrug of P-88-8991. 4,7,10,13,16,19-Docosahexaenoyl chloride can be used for the research of mental disorders (schizophrenia, bipolar disorder).
    4,7,10,13,16,19-Docosahexaenoyl chloride
  • HY-W751034A
    (R)-Ozanimod hydrochloride 1306760-85-9 98%
    (R)-Ozanimod (hydrochloride) is the R-isomer of Ozanimod hydrochloride (HY-12288A).
    (R)-Ozanimod hydrochloride
  • HY-W783639S
    Bzo-poxizid-d9 98%
    Bzo-poxizid-d9 (5C-MDA-19-d9, Petyl MDA-19-d9) is deuterium labeled Bzo-poxizid. Bzo-poxizid is a synthetic cannabinoid that is a psychoactive substance.
    Bzo-poxizid-d9
  • HY-100013A1R
    (1R,2R)-2-PCCA hydrochloride (Standard) 1609563-71-4 98%
    (1R,2R)-2-PCCA (hydrochloride) (Standard) is the analytical standard of (1R,2R)-2-PCCA (hydrochloride) (HY-100013A1). This product is intended for research and analytical applications. (1R,2R)-2-PCCA hydrochloride is a diastereomer of 2-PCCA, and acts as a potent GPR88 receptor agonist, with an EC50 of 3 nM in cell-free assay, and 603 nM in cell assay.
    (1R,2R)-2-PCCA hydrochloride (Standard)
  • HY-100013B1R
    (1S,2S)-2-PCCA hydrochloride (Standard) 1609563-70-3 98%
    (1S,2S)-2-PCCA (hydrochloride) (Standard) is the analytical standard of (1S,2S)-2-PCCA (hydrochloride) (HY-100013B1). This product is intended for research and analytical applications. (1S,2S)-2-PCCA hydrochloride is a less active diastereomer of 2-PCCA. 2-PCCA is a GPR88 receptor agonist, and inhibits GPR88-mediated cAMP production, with an EC50 of 116 nM in HEK293 cells.
    (1S,2S)-2-PCCA hydrochloride (Standard)
  • HY-W012531S2
    2-Hydroxycinnamic acid-d4 98%
    2-Hydroxycinnamic acid-d4 is deuterium labeled 2-Hydroxycinnamic acid. 2-Hydroxycinnamic acid is a phenolic acid with antimicrobial and antioxidant properties. 2-Hydroxycinnamic acid has antimicrobial activity against Staphylococcus aureus and is not susceptible to drug resistance. 2-Hydroxycinnamic acid shows inhibitory effects on infection of HIV/SARS-CoV S pseudovirus with an IC50 of 0.3 mM. In addition, 2-Hydroxycinnamic acid has neuroprotective and antitumor activity.
    2-Hydroxycinnamic acid-d4
  • HY-W012836S2
    4-Ethylphenol-d2 1335401-68-7 98%
    4-Ethylphenol-d2 is deuterated labeled 4-Ethylphenol (HY-W012836). 4-Ethylphenol is a volatile phenolic compound associated with off-odour in wine. 4-Ethylphenol is a phenolic compound that can be synthesized by intestinal flora. 4-Ethylphenol will be converted to 4-ethylphenyl sulfate (HY-W674241) by Lactobacillus plantarum.
    4-Ethylphenol-d2
  • HY-W012889S3
    DL-Valine-d1-1 79168-24-4 98%
    DL-Valine-d-1 is the deuterium labeled DL-Valine.
    DL-Valine-d1-1
  • HY-W012998S1
    2,3-Pentanedione-13C2 3028870-57-4 98%
    2,3-Pentanedione-13C2 is 13C labeled 2,3-Pentanedione (HY-W012998). 2,3-Pentanedione is a common constituent of synthetic flavorings and is used to impart a butter, strawberry, caramel, fruit, rum, or cheese flavor in beverages, ice cream, candy, baked goods, gelatins, and puddings. 2,3-Pentanedione also occurs naturally as a fermentation product in beer, wine, and yogurt and is releasedduring roasting of coffee beans.
    2,3-Pentanedione-13C2
  • HY-W012998S2
    2,3-Pentanedione-d3 150678-00-5 98%
    2,3-Pentanedione-d3 is deuterated labeled 2,3-Pentanedione (HY-W012998). 2,3-Pentanedione is a common constituent of synthetic flavorings and is used to impart a butter, strawberry, caramel, fruit, rum, or cheese flavor in beverages, ice cream, candy, baked goods, gelatins, and puddings. 2,3-Pentanedione also occurs naturally as a fermentation product in beer, wine, and yogurt and is releasedduring roasting of coffee beans.
    2,3-Pentanedione-d3
  • HY-W014901S1
    Bisphenol F-13C12 1410794-08-9 98%
    Bisphenol F-13C12 is the 13C labeled Bisphenol F (HY-W014901). Bisphenol F is an orally active endocrine disruptor. Bisphenol F promotes ROS generation, upregulates p-AKT/p-GSK3β, and induces Apoptosis. Bisphenol F interferes with glucose metabolism, affects neurodevelopment and reproductive function. Bisphenol F reduces social novelty preference in mouse offspring. Bisphenol F can be used in bone, blood, and fat-related studies. Bisphenol F is used as a substitute for Bisphenol A (HY-18260).
    Bisphenol F-13C12
  • HY-W015169AR
    5-Methoxytryptamine hydrochloride (Standard) 66-83-1 98%
    5-Methoxytryptamine (hydrochloride) (Standard) is the analytical standard of 5-Methoxytryptamine (hydrochloride) (HY-W015169A). This product is intended for research and analytical applications. 5-Methoxytryptamine hydrochloride, a metabolite of Melatonin, is a nonselective 5-HT receptor agonist. 5-Methoxytryptamine hydrochloride has no affinity for the 5-HT3 receptor. 5-Methoxytryptamine hydrochloride is also a potent antioxidant and has radioprotective action.
    5-Methoxytryptamine hydrochloride (Standard)
  • HY-P3431
    VSGLNPSLWSIFGLQFILLWLVSGSRHYLW 2279952-25-7 98%
    VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain.
    VSGLNPSLWSIFGLQFILLWLVSGSRHYLW
  • HY-107605
    UBP296 745055-86-1 98%
    UBP296 is a potent and selective antagonist of GLUK5-containing kainate receptor in the spinal cord. UBP296 reversibly blocks ATPA-induced depressions of synaptic transmission, and affects AMPA receptor-mediated synaptic transmission directly in rat hippocampal slices.
    UBP296
  • HY-115650
    TAE-1 1414469-59-2
    TAE-1 is a potent inhibitor of AChE and BuChE. TAE-1 also inhibits Aβ fibril formation and aggregation. TAE-1 can be used for the researches of Alzheimer's disease.
    TAE-1
  • HY-120024
    BMS-986188 1776115-10-6 99.06%
    BMS-986188 is a selective positive allosteric modulator of δ-opioid receptor with an EC50 of 0.05 μM.
    BMS-986188
  • HY-121736
    AGI-12026 1446501-77-4 98%
    AGI-12026 is brain-penetrant dual inhibitor of mutant IDH1 and 2. AGI-12026 shows partial inhibition of the IDH1-R132H homodimer as allosteric modulators. AGI-12026 has the potential for research of glioma.
    AGI-12026
  • HY-135154
    epi-Aszonalenin A 908853-14-5 98%
    epi-Aszonalenin A is a benzodiazepine fungal metabolite originally isolated from Aspergillus novofumigatus. epi-Aszonalenin A can be used as a psychoactive agent.
    epi-Aszonalenin A
  • HY-N10356
    4,27-Dimethyl withaferin A 1777780-95-6 98%
    4,27-Dimethyl withaferin A is a synthetic analog of withanolide natural products. 4,27-Dimethyl withaferin A has the potential for the research of neurodegenerative diseases (extracted from patent WO2015077780A1).
    4,27-Dimethyl withaferin A
Cat. No. Product Name / Synonyms Application Reactivity